DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and CG10359

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster


Alignment Length:242 Identity:94/242 - (38%)
Similarity:125/242 - (51%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LFYLASAEIGENVKIQTYKKYSSSCKELNPKKSGVQKIQV--GSDVIEVYCDVTIAGKGWLVVQR 77
            :||..|   |.|....| ::..|||........|:.|:|:  .|:...|.||     :.|.|:..
  Fly   252 IFYGPS---GLNGPTAT-RQLPSSCSYSFLSNHGILKVQLTPESESFYVSCD-----EDWTVILS 307

  Fly    78 RVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHV 142
            |.|.:.||.|.|..|:.|||:|.|:||||||.|:.::|....||.|.:.||:|...||.||:|.:
  Fly   308 RTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAI 372

  Fly   143 GNVYSNYPITQLGAY----SGTAGDSLSYHLYQPFSTFDRDNDNA-TINCAARYMGAWWYRECLS 202
            |:....||:..||.:    :.:||||||||....|||.|:||||. ..|||.|:.||.|:..|..
  Fly   373 GSEKELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAK 437

  Fly   203 RIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
                |||.|.|...|....    :||.|..:.| ..|.|.|..|:||
  Fly   438 ----SNLFGEYTTQNQPGE----TGIWWDTFSG-QNSLKRVRWMIRP 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 88/223 (39%)
CG10359NP_001137882.1 FReD 267..476 CDD:238040 88/223 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467652
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
87.850

Return to query results.
Submit another query.