DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and sca

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster


Alignment Length:234 Identity:65/234 - (27%)
Similarity:98/234 - (41%) Gaps:34/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ENVKIQ---TYKKYSSSCKELNPKKSGVQKIQVGSD--VIEVYCDVTIAGKGWLVVQRRVSVEEN 84
            |||:.|   ...|....|.|::.:..|:..|.....  .:..:|    ...||..||||.....:
  Fly   525 ENVETQYEAIINKLPHDCSEVHTQTDGLHLIAPAGQRHPLMTHC----TADGWTTVQRRFDGSAD 585

  Fly    85 FYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNY 149
            |.|:|..|..|||...|.|:||...|:.::......|.:::.|.......|.|..|::.:....|
  Fly   586 FNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISSRADGY 650

  Fly   150 PITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYL 214
            .: .:..|||.|.|:|:|.....||..|.|.|.:..:|||.|.|.||:..|..    :||||.| 
  Fly   651 RL-HIAEYSGNASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQH----ANLNGRY- 709

  Fly   215 GGNHTDPALFGSGIVW-----GEWKGFTYSYKTVNIMVR 248
                      ..|:.|     .||    .:.|:..::|:
  Fly   710 ----------NLGLTWFDAARNEW----IAVKSSRMLVK 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 61/222 (27%)
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 60/221 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.