DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and sca

DIOPT Version :10

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster


Alignment Length:234 Identity:65/234 - (27%)
Similarity:98/234 - (41%) Gaps:34/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ENVKIQ---TYKKYSSSCKELNPKKSGVQKIQVGSD--VIEVYCDVTIAGKGWLVVQRRVSVEEN 84
            |||:.|   ...|....|.|::.:..|:..|.....  .:..:|    ...||..||||.....:
  Fly   525 ENVETQYEAIINKLPHDCSEVHTQTDGLHLIAPAGQRHPLMTHC----TADGWTTVQRRFDGSAD 585

  Fly    85 FYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNY 149
            |.|:|..|..|||...|.|:||...|:.::......|.:::.|.......|.|..|::.:....|
  Fly   586 FNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISSRADGY 650

  Fly   150 PITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYL 214
            .: .:..|||.|.|:|:|.....||..|.|.|.:..:|||.|.|.||:..|..    :||||.| 
  Fly   651 RL-HIAEYSGNASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQH----ANLNGRY- 709

  Fly   215 GGNHTDPALFGSGIVW-----GEWKGFTYSYKTVNIMVR 248
                      ..|:.|     .||    .:.|:..::|:
  Fly   710 ----------NLGLTWFDAARNEW----IAVKSSRMLVK 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 61/222 (27%)
scaNP_476710.2 PRK03918 134..>485 CDD:235175
FBG 538..736 CDD:214548 60/221 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.