DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Angptl4

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_954546.1 Gene:Angptl4 / 362850 RGDID:735058 Length:405 Species:Rattus norvegicus


Alignment Length:226 Identity:73/226 - (32%)
Similarity:120/226 - (53%) Gaps:29/226 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CKEL---NPKKSGVQKIQ-VGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDL 99
            |:||   ..:.||:.:|| :||....|.|::|..| ||.|:|||::...:|.::|.:|:.||||.
  Rat   187 CQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDG-GWTVIQRRLNGSVDFNQSWEAYKDGFGDP 250

  Fly   100 KGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPI-------TQLGAY 157
            :|.|::||..::.|:..:..:|.::|.|:.|..:...:.: |:|...:.|.:       .:||| 
  Rat   251 QGEFWLGLEKMHSITGDRGSQLAVQLQDWDGNAKLLQFPI-HLGGEDTAYSLQLTEPTANELGA- 313

  Fly   158 SGTAGDSLSYHLYQPFSTFDRDND-NATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDP 221
            :..:.:.||.    ||||:|:|:| ...:|||....|.||:..|..    |||||.|.   |:.|
  Rat   314 TNVSPNGLSL----PFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSH----SNLNGQYF---HSIP 367

  Fly   222 ---ALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
               .....||.|..|||..|..:...::::|
  Rat   368 RQRQQRKKGIFWKTWKGRYYPLQATTLLIQP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 73/226 (32%)
Angptl4NP_954546.1 FReD 182..399 CDD:238040 73/226 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.