DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Fga

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001008724.1 Gene:Fga / 361969 RGDID:2603 Length:782 Species:Rattus norvegicus


Alignment Length:262 Identity:90/262 - (34%)
Similarity:130/262 - (49%) Gaps:38/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ASAEIGENVKIQTYKKYSS----SCKE-LNPKKSGVQ------KIQVGSDVIEVYCDVTIAGKGW 72
            |::|..:....:|.|:..:    .|.: |....||.|      |:...|.:..||||...:..||
  Rat   524 AASEAHQEGDTRTTKRGRARTMRDCDDVLQTHPSGAQNGIFSIKLPGSSKIFSVYCDQETSLGGW 588

  Fly    73 LVVQRRVSVEENFYRNWTSYQTGFGDL----KGNFFIGLNNLNKISSLQPQELYIELVDFAGEKR 133
            |::|:|:....||.|.|..|:.|||.|    :|.|::| |:...:.:|:...|.:||.|:||::.
  Rat   589 LLIQQRMDGSLNFNRTWQDYKRGFGSLNDKGEGEFWLG-NDYLHLLTLRGSVLRVELEDWAGKEA 652

  Fly   134 YAHYSVFHVGNVYSNYPITQLGAYSGTAGDSL-----------SYHLYQPFSTFDRDNDNATINC 187
            ||.|. |.||:....|.: |:.:|.|||||:|           :.|....|||||||.|....||
  Rat   653 YAEYH-FRVGSEAEGYAL-QVSSYQGTAGDALMEGSVEEGTEYTSHSNMQFSTFDRDADQWEENC 715

  Fly   188 AARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPA-----LFGSGIVWGEWKGFTYSYKTVNIMV 247
            |..|.|.|||..|    ..:||||.|..|...||.     ...:|:||..::|..||.:.|.:.:
  Rat   716 AEVYGGGWWYNSC----QAANLNGIYYPGGTYDPRNNSPYEIENGVVWVPFRGADYSLRAVRMKI 776

  Fly   248 RP 249
            ||
  Rat   777 RP 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 86/247 (35%)
FgaNP_001008724.1 Fib_alpha 51..189 CDD:285864
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..374
Fibrinogen_aC 388..453 CDD:288972
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..542 4/17 (24%)
FReD 546..779 CDD:238040 86/240 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.