DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and CG8642

DIOPT Version :10

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster


Alignment Length:186 Identity:89/186 - (47%)
Similarity:109/186 - (58%) Gaps:10/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 TIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAG 130
            |.||.||..:|||:....||||||.:|..|||.|.|.|||||..|::::|.||.||||.:..|.|
  Fly   237 TAAGPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGG 301

  Fly   131 EKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNAT-INCAARYMGA 194
            |..||||..|.:|:....|.:..||.|.|.|.|:|..|....|||:|||||..| :|||..:.||
  Fly   302 ETSYAHYDDFLIGSEEEGYELKLLGHYQGNASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGA 366

  Fly   195 WWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRPK 250
            |||..| ||   |||||.|..|...:|    ..|.|..|..|. |.|:|.:::|||
  Fly   367 WWYDFC-SR---SNLNGRYFKGEVDNP----QSIYWEPWYSFR-SLKSVQMLIRPK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 87/184 (47%)
CG8642NP_610396.2 MAD 71..>198 CDD:461677
FReD 213..413 CDD:238040 87/184 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.