DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and CG9500

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:252 Identity:105/252 - (41%)
Similarity:141/252 - (55%) Gaps:21/252 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LFYLASAEIGENVKIQTYKKYSSSCKELN---------------PKKSGVQKIQV-GSDVIEVYC 63
            |:.|..|.:.||....:.:....|..:||               |...|:..:|| |....:|.|
  Fly    41 LYKLVLALLEENQSNASTENIQKSSSDLNTTGLSGRYPSQCPTYPPAHGIYTVQVLGLKPFQVSC 105

  Fly    64 DVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDF 128
            |..|||.||.|:.||.|.:.||:|:|..|:.|||.|.|:|||||:.|:.|:..||.||||.|.||
  Fly   106 DAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDF 170

  Fly   129 AGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMG 193
            .|:.|||||....:.:....|.:|:||.::|.||||:.::..|.|||||||||....|||..|:|
  Fly   171 EGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVG 235

  Fly   194 AWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRPK 250
            |||:..|    ..|||.|.|:.|:......: .||||..|:..:||||.:.:|||||
  Fly   236 AWWHLNC----TYSNLFGIYVKGDEGQYFQW-KGIVWHSWRTESYSYKVMQMMVRPK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 98/231 (42%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 95/215 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467658
Domainoid 1 1.000 118 1.000 Domainoid score I3641
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D49112at7147
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
109.900

Return to query results.
Submit another query.