DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and CG31832

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:254 Identity:98/254 - (38%)
Similarity:141/254 - (55%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKPICFALCVFSLGLFYLASAEIGENVKIQTYKKYSSSCKELNPKKSGVQKIQVGSDVIEVY--- 62
            ||...|.|.:::| ||     |:|::        ...:|...:|  :|:.::.:..:  |.:   
  Fly     1 MKSCFFVLFLWTL-LF-----EVGQS--------SPHTCPSGSP--NGIHQLMLPEE--EPFQVT 47

  Fly    63 -CDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELV 126
             |..|  .:.|:|:|||:....||.::|.||:.||||..|.|||||..|..::..||.||:|:|.
  Fly    48 QCKTT--ARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLK 110

  Fly   127 DFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARY 191
            ...|...|||:..|.|.:....|.:.::|.|||||||||.||:.:.|||||||||.::.||||.:
  Fly   111 HGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEH 175

  Fly   192 MGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRPK 250
            .|.||:..|||    |:|||.|.....|...   :||.||.||..:.::  |.||:|||
  Fly   176 GGGWWFHSCLS----SSLNGLYFREGETGML---NGIHWGRWKFQSLTF--VQIMIRPK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 87/219 (40%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 86/211 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446515
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D84222at33392
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
98.900

Return to query results.
Submit another query.