DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Fibcd1

DIOPT Version :10

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001101299.1 Gene:Fibcd1 / 311861 RGDID:1309097 Length:459 Species:Rattus norvegicus


Alignment Length:196 Identity:86/196 - (43%)
Similarity:115/196 - (58%) Gaps:15/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 EVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIE 124
            :||||:...|.||.|.|||.....||:|.|.:|:.|||.|.|..::||..::.:::....||:::
  Rat   268 QVYCDMRTDGGGWTVFQRREDGSVNFFRGWEAYREGFGKLTGEHWLGLKRIHALTTQAAYELHVD 332

  Fly   125 LVDFAGEKRYAHYSVFHVGNVYS------NYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNA 183
            |.||.....||||..|.|| ::|      .||:| :..|||||||||..|....|:|.|||:|::
  Rat   333 LEDFDNGTAYAHYGSFGVG-LFSVDPEEDGYPLT-VADYSGTAGDSLLKHSGMRFTTKDRDSDHS 395

  Fly   184 TINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVR 248
            ..||||.|.||||||.|.:    |||||.||.|.|   |.:..|:.|..|.|:.||.|...:.:|
  Rat   396 ENNCAAFYRGAWWYRNCHT----SNLNGQYLRGPH---ASYADGVEWSSWTGWQYSLKFSEMKIR 453

  Fly   249 P 249
            |
  Rat   454 P 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 86/196 (44%)
Fibcd1NP_001101299.1 FReD 239..455 CDD:238040 86/196 (44%)

Return to query results.
Submit another query.