DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Angptl3

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_038941.1 Gene:Angptl3 / 30924 MGIID:1353627 Length:455 Species:Mus musculus


Alignment Length:207 Identity:65/207 - (31%)
Similarity:96/207 - (46%) Gaps:14/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SGVQKIQV-GSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNL 110
            |||..|:. .|....|||| |.:|..|.::|.|....::|...|.:|:.|||.|.|.|::|   |
Mouse   257 SGVYTIKPRNSQGFNVYCD-TQSGSPWTLIQHRKDGSQDFNETWENYEKGFGRLDGEFWLG---L 317

  Fly   111 NKISSLQPQELYI---ELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQP 172
            .||.::..|..||   ||.|:...|.|..|| ||:|:..:||.: .:...:|....:|..|....
Mouse   318 EKIYAIVQQSNYILRLELQDWKDSKHYVEYS-FHLGSHETNYTL-HVAEIAGNIPGALPEHTDLM 380

  Fly   173 FSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFT 237
            |||::. .....:.|...|.|.||:.:....   :||||.|.............||.|.......
Mouse   381 FSTWNH-RAKGQLYCPESYSGGWWWNDICGE---NNLNGKYNKPRTKSRPERRRGIYWRPQSRKL 441

  Fly   238 YSYKTVNIMVRP 249
            |:.|:..:|::|
Mouse   442 YAIKSSKMMLQP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 65/207 (31%)
Angptl3NP_038941.1 Sufficient to inhibit LIPG/EL phospholipase activity. /evidence=ECO:0000250|UniProtKB:Q9Y5C1 17..207
Sufficient to inhibit LPL lipase activity. /evidence=ECO:0000250|UniProtKB:Q9Y5C1, ECO:0000269|PubMed:20581395 17..165
Required for inhibition of LPL lipase activity. /evidence=ECO:0000250|UniProtKB:Q9Y5C1 32..56
SPEC <34..191 CDD:295325
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..242
FReD 241..453 CDD:238040 64/205 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.