DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and tnn

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_005171321.1 Gene:tnn / 30234 ZFINID:ZDB-GENE-990415-262 Length:1020 Species:Danio rerio


Alignment Length:262 Identity:83/262 - (31%)
Similarity:129/262 - (49%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FYLASAEIGEN--VKIQTYK-------------------KYSSSCKEL---NPKKSGVQKIQVG- 55
            |.|:..|:|:.  |.:..|:                   ::...|.::   ...:|||..|.|. 
Zfish   753 FALSGLEMGKKYIVTLIAYRGSKRSKIVETTFSTVGLAYQFPMDCTQIMRNGNMESGVYTIYVNN 817

  Fly    56 --SDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQP 118
              |..::||||:...|.||:|.|||.:.:.:|.:.|..|..|||:|...|::||:.::::::...
Zfish   818 NRSRTMQVYCDMKTDGGGWIVFQRRNTGKVDFMKKWRDYMKGFGELTEEFWLGLDKIHELTNTPT 882

  Fly   119 Q-ELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDN 182
            | |...:| ....:::||.|..|.|......:.:| :|:|.|.|||:::||...||||.|.|||.
Zfish   883 QYEARFDL-GSGSDRKYAVYDNFKVAPSKQKFKLT-IGSYKGNAGDAMTYHQGAPFSTVDSDNDI 945

  Fly   183 ATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMV 247
            |..|||..:.|||||:.|    ..:||||.:....|:      .|:.|..|||...|.....|.:
Zfish   946 ALGNCALTHQGAWWYKNC----HLANLNGRFGDNRHS------MGVNWEPWKGHLQSLDFAEIKI 1000

  Fly   248 RP 249
            ||
Zfish  1001 RP 1002

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 77/223 (35%)
tnnXP_005171321.1 EGF_alliinase <133..163 CDD:282688
EGF_2 161..189 CDD:285248
EGF_2 193..220 CDD:285248
EGF_2 224..251 CDD:285248
fn3 257..333 CDD:278470
fn3 344..426 CDD:278470
fn3 435..514 CDD:278470
fn3 523..602 CDD:278470
fn3 611..683 CDD:278470
fn3 699..773 CDD:278470 6/19 (32%)
FReD 792..1003 CDD:238040 77/223 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3724
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.