DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Angptl6

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001100172.1 Gene:Angptl6 / 298698 RGDID:1311141 Length:457 Species:Rattus norvegicus


Alignment Length:203 Identity:78/203 - (38%)
Similarity:116/203 - (57%) Gaps:6/203 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KSGVQKIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNL 110
            :|||.::::|..|:.|:|:....|.||.|:|||.....||:.||..|:.|||...|.:::||..:
  Rat   257 QSGVYELRLGRRVVPVWCEQQQEGGGWTVIQRRQDGSVNFFTNWQHYKVGFGRPDGEYWLGLEPV 321

  Fly   111 NKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFST 175
            ::::|....||.|.|.|:.|....|||..|.:.....:|.: :||.|.|.||||||:|..:||:|
  Rat   322 HQVTSRGDHELLILLKDWGGRGARAHYDSFSLEPESDHYRL-RLGQYHGDAGDSLSWHSDKPFNT 385

  Fly   176 FDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSY 240
            .|||.|:.:.|||..:.|.|||..|..    |||||.:..|.|. .:.:..|:.|.|::|..||.
  Rat   386 VDRDRDSYSGNCALYHRGGWWYHACAH----SNLNGVWYHGGHY-RSRYQDGVYWAEFRGGAYSL 445

  Fly   241 KTVNIMVR 248
            |...::.|
  Rat   446 KKAAMLTR 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 78/203 (38%)
Angptl6NP_001100172.1 Uso1_p115_C 66..>157 CDD:282695
FReD 242..453 CDD:238040 77/201 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.