DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Mfap4

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_006246622.1 Gene:Mfap4 / 287382 RGDID:1307841 Length:281 Species:Rattus norvegicus


Alignment Length:219 Identity:82/219 - (37%)
Similarity:109/219 - (49%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNF-------------------- 103
            :.|:||:|..|..|.|.|:|.:...:|:|.|..|:.|||...|.:                    
  Rat    68 VPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGKVGSWGGGCPLANSWLT 132

  Fly   104 ----FIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVG-NVYS----NYPITQLGAYSG 159
                ::||.||:.::..|..||.::|.||.....||.|..|.:. |..|    .|.:...|...|
  Rat   133 SCHPYLGLQNLHLLTLKQKYELRVDLEDFENNTAYAKYVDFSISPNAVSAEEDGYTLYVAGFEDG 197

  Fly   160 TAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALF 224
            .||||||||..|.|||||||.|....||||...||:|:|.|    ..:||||.||||:|..   :
  Rat   198 GAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSC----HFANLNGFYLGGSHLS---Y 255

  Fly   225 GSGIVWGEWKGFTYSYKTVNIMVR 248
            .:||.|.:||||.||.|...:.:|
  Rat   256 ANGINWAQWKGFYYSLKRTEMKIR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 82/219 (37%)
Mfap4XP_006246622.1 FReD 38..280 CDD:238040 82/219 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.