DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and ANGPT1

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001137.2 Gene:ANGPT1 / 284 HGNCID:484 Length:498 Species:Homo sapiens


Alignment Length:211 Identity:77/211 - (36%)
Similarity:114/211 - (54%) Gaps:18/211 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KSGVQKIQVGS--DVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLN 108
            |||:..|.:.:  :..:|:|::.:.|.||.|:|.|.....:|.|.|..|:.|||:..|.:::|..
Human   296 KSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE 360

  Fly   109 NLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLY-QP 172
            .:..|:|.:...|.|||:|:.|.:.|:.|..||:||...||.: .|..::||||...|..|: ..
Human   361 FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRL-YLKGHTGTAGKQSSLILHGAD 424

  Fly   173 FSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAY--LGGNHTDPALFG--SGIVWGEW 233
            |||.|.||||....||....|.||:..|    ..|||||.:  .|.||      |  :||.|..:
Human   425 FSTKDADNDNCMCKCALMLTGGWWFDAC----GPSNLNGMFYTAGQNH------GKLNGIKWHYF 479

  Fly   234 KGFTYSYKTVNIMVRP 249
            ||.:||.::..:|:||
Human   480 KGPSYSLRSTTMMIRP 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 77/211 (36%)
ANGPT1NP_001137.2 Smc <81..280 CDD:224117
FReD 281..496 CDD:238040 77/211 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41874
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.