Sequence 1: | NP_001246376.1 | Gene: | CG5550 / 36883 | FlyBaseID: | FBgn0034160 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055310.1 | Gene: | ANGPTL3 / 27329 | HGNCID: | 491 | Length: | 460 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 69/205 - (33%) |
---|---|---|---|
Similarity: | 99/205 - (48%) | Gaps: | 10/205 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 SGVQKIQ-VGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNL 110
Fly 111 NKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFST 175
Fly 176 FDRDNDNATINCAARYMGAWWYR-ECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYS 239
Fly 240 YKTVNIMVRP 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5550 | NP_001246376.1 | FReD | 34..250 | CDD:238040 | 69/205 (34%) |
ANGPTL3 | NP_055310.1 | SMC_N | <84..>215 | CDD:330553 | |
FReD | 243..453 | CDD:238040 | 68/203 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |