DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and ANGPTL3

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_055310.1 Gene:ANGPTL3 / 27329 HGNCID:491 Length:460 Species:Homo sapiens


Alignment Length:205 Identity:69/205 - (33%)
Similarity:99/205 - (48%) Gaps:10/205 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SGVQKIQ-VGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNL 110
            ||:..|: ..|.|..||||| |:|..|.::|.|:...:||...|.:|:.|||.|.|.|::||..:
Human   257 SGMYAIRPSNSQVFHVYCDV-ISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKI 320

  Fly   111 NKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFST 175
            ..|.......|.|||.|:...|.|..|| |::||..:||.: .|.|.:|...:::..:....|||
Human   321 YSIVKQSNYVLRIELEDWKDNKHYIEYS-FYLGNHETNYTL-HLVAITGNVPNAIPENKDLVFST 383

  Fly   176 FDRDNDNATINCAARYMGAWWYR-ECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYS 239
            :|. ......||...|.|.||:. ||..    :||||.|.............|:.|....|..||
Human   384 WDH-KAKGHFNCPEGYSGGWWWHDECGE----NNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYS 443

  Fly   240 YKTVNIMVRP 249
            .|:..:::.|
Human   444 IKSTKMLIHP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 69/205 (34%)
ANGPTL3NP_055310.1 SMC_N <84..>215 CDD:330553
FReD 243..453 CDD:238040 68/203 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.