DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Tnr

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_037177.2 Gene:Tnr / 25567 RGDID:3886 Length:1358 Species:Rattus norvegicus


Alignment Length:206 Identity:87/206 - (42%)
Similarity:126/206 - (61%) Gaps:15/206 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SGVQKIQVGSDV---IEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLN 108
            |||..|.:..::   ::||||:|..|.||:|.|||.:.:.:|:|.|..|:.|||:|:..|::||:
  Rat  1149 SGVYTIFLNGELSHKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVGFGNLEDEFWLGLD 1213

  Fly   109 NLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPF 173
            |:::|::....||.:::.| ..|..:|:|..|.|.:..|.|.: ::|.|:||||||||||..:||
  Rat  1214 NIHRITAQGRYELRVDMRD-GQEAVFAYYDKFAVEDSRSLYKL-RIGGYNGTAGDSLSYHQGRPF 1276

  Fly   174 STFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTY 238
            ||.|||||.|..|||..|.|||||:.|..    :||||.|....|:      .||.|..|||..:
  Rat  1277 STEDRDNDVAVTNCAMSYKGAWWYKNCHR----TNLNGKYGESRHS------QGINWYHWKGHEF 1331

  Fly   239 SYKTVNIMVRP 249
            |...|.:.:||
  Rat  1332 SIPFVEMKMRP 1342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 87/206 (42%)
TnrNP_037177.2 exchanger_TraA <190..>328 CDD:411343
EGF_Tenascin 203..231 CDD:376143
fn3 328..398 CDD:394996
fn3 416..496 CDD:394996
fn3 507..586 CDD:394996
FN3 595..679 CDD:238020
fn3 687..766 CDD:394996
fn3 776..855 CDD:394996
fn3 865..944 CDD:394996
fn3 954..1026 CDD:394996
FN3 1042..1127 CDD:238020
FReD 1134..1342 CDD:238040 85/204 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3664
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.