Sequence 1: | NP_001246376.1 | Gene: | CG5550 / 36883 | FlyBaseID: | FBgn0034160 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_037177.2 | Gene: | Tnr / 25567 | RGDID: | 3886 | Length: | 1358 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 87/206 - (42%) |
---|---|---|---|
Similarity: | 126/206 - (61%) | Gaps: | 15/206 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 SGVQKIQVGSDV---IEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLN 108
Fly 109 NLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPF 173
Fly 174 STFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTY 238
Fly 239 SYKTVNIMVRP 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5550 | NP_001246376.1 | FReD | 34..250 | CDD:238040 | 87/206 (42%) |
Tnr | NP_037177.2 | exchanger_TraA | <190..>328 | CDD:411343 | |
EGF_Tenascin | 203..231 | CDD:376143 | |||
fn3 | 328..398 | CDD:394996 | |||
fn3 | 416..496 | CDD:394996 | |||
fn3 | 507..586 | CDD:394996 | |||
FN3 | 595..679 | CDD:238020 | |||
fn3 | 687..766 | CDD:394996 | |||
fn3 | 776..855 | CDD:394996 | |||
fn3 | 865..944 | CDD:394996 | |||
fn3 | 954..1026 | CDD:394996 | |||
FN3 | 1042..1127 | CDD:238020 | |||
FReD | 1134..1342 | CDD:238040 | 85/204 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 170 | 1.000 | Domainoid score | I3664 |
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | mtm12326 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR19143 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.910 |