DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and CG30281

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster


Alignment Length:277 Identity:110/277 - (39%)
Similarity:148/277 - (53%) Gaps:38/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FALCVF--------------SLGLFYLASAEIGENVKI------QTYKKYS-----------SSC 39
            :.|||.              .|.|.|..:..:..::||      |:||:.:           |||
  Fly     4 YLLCVLILSGGSLLSTAQSNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERGSHETINPSSC 68

  Fly    40 KELNPKKSGVQKIQV-GSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNF 103
            .......:|:..|:| |.:...||||..:||.||.|:|||....|||||.|..|..|||:|.|.|
  Fly    69 LAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEF 133

  Fly   104 FIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYH 168
            |:||..|:.:::.:|.||::.:.||.|....|.|..|.:||..::|.::.||.|||.|||||.||
  Fly   134 FMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRYH 198

  Fly   169 LYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEW 233
            ...||||||.|:...  .||..|:|||||.:|..    |||||.||.|...:|.:.|.||.|..|
  Fly   199 KGMPFSTFDHDDTGH--GCARIYVGAWWYDQCQR----SNLNGQYLEGGRFEPKMSGRGITWMSW 257

  Fly   234 KGFTYSYKTVNIMVRPK 250
            :|:.|.||.|.:|:|||
  Fly   258 RGYDYGYKFVQMMIRPK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 97/227 (43%)
CG30281NP_726164.1 FReD 63..274 CDD:238040 97/216 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446509
Domainoid 1 1.000 118 1.000 Domainoid score I3641
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D49112at7147
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
109.900

Return to query results.
Submit another query.