DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Fgl1

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_742007.2 Gene:Fgl1 / 246186 RGDID:620169 Length:314 Species:Rattus norvegicus


Alignment Length:239 Identity:93/239 - (38%)
Similarity:125/239 - (52%) Gaps:33/239 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KKYSSSCKEL---NPKKSGVQKIQVGSDVIE--VYCDVTIAGKGWLVVQRRVSVEENFYRNWTSY 92
            |::.:.|.|:   ..|.||..||:....:.|  ||||::..| ||.|:|||....|||.|.|..|
  Rat    79 KRHYADCSEIYNDGFKHSGFYKIKPLQSLAEFSVYCDMSDGG-GWTVIQRRSDGSENFNRGWNDY 142

  Fly    93 QTGFGDL---KGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQL 154
            :.|||:.   .|.:::|..|:|.::......|.|:|.||....|:|.|..|.||:..|.|.: .:
  Rat   143 ENGFGNFVQSNGEYWLGNKNINLLTMQGDYTLKIDLTDFEKNSRFAQYEKFKVGDEKSFYEL-NI 206

  Fly   155 GAYSGTAGDSLS-----------YHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSN 208
            |.||||||||||           .|....|||.||||||...|||......||:..|.|    :|
  Rat   207 GEYSGTAGDSLSGTFHPEVQWWASHQTMKFSTRDRDNDNYNGNCAEEEQSGWWFNRCHS----AN 267

  Fly   209 LNGAYLGGNH---TDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            |||.|..|.:   ||     :|:||..|:|:.||.|:|.:.:||
  Rat   268 LNGVYYQGPYRAETD-----NGVVWYTWRGWWYSLKSVVMKIRP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 92/238 (39%)
Fgl1NP_742007.2 FReD 80..306 CDD:238040 90/236 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.