DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Fgg

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_006232587.1 Gene:Fgg / 24367 RGDID:2613 Length:445 Species:Rattus norvegicus


Alignment Length:250 Identity:74/250 - (29%)
Similarity:116/250 - (46%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IQTYKKYSSSCKEL---NPKKSGVQKIQ--VGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRN 88
            ::.:......|:::   ..|:||:..|:  ..:....|||::..:|.||.|:|:|:....:|.:|
  Rat   169 VRIHDTTGKDCQDIANKGAKESGLYFIRPLKATQQFLVYCEIDGSGNGWTVLQKRLDGSVDFKKN 233

  Fly    89 WTSYQTGFGDLK----GNFFIGLNNLNKIS--SLQPQELYIELVDFAGEKRYAHYSVFHVGNVYS 147
            |..|:.|||.|.    ..|::|...::.||  |..|..|.|:|.|::|....|.|::|.||....
  Rat   234 WIQYKEGFGHLSPTGTTEFWLGNEKIHLISMQSTIPYALRIQLKDWSGRTSTADYAMFRVGPESD 298

  Fly   148 NYPITQLGAYSGTAGDS--------------LSYHLYQPFSTFDRDNDNATINCAARYMGAWWYR 198
            .|.:|......|.|||:              .:.|....|||:|.|||....|||.:....||..
  Rat   299 KYRLTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMHFSTWDNDNDKFEGNCAEQDGSGWWMN 363

  Fly   199 ECLSRIPCSNLNGAYL-GGNH---TDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            :|    ...:|||.|. ||.:   :.|..:.:||:|..||...||.|...:.:.|
  Rat   364 KC----HAGHLNGVYYQGGTYSKSSTPNGYDNGIIWATWKTRWYSMKETTMKIIP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 73/244 (30%)
FggXP_006232587.1 Fib_alpha 31..172 CDD:400857 0/2 (0%)
Fibrinogen_C 175..414 CDD:395095 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.