DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and ANGPTL2

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_036230.1 Gene:ANGPTL2 / 23452 HGNCID:490 Length:493 Species:Homo sapiens


Alignment Length:228 Identity:80/228 - (35%)
Similarity:126/228 - (55%) Gaps:20/228 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SSSCKELNPKKSGVQKIQVGSD--------------VIEVYCDVTIAGKGWLVVQRRVSVEENFY 86
            ||:.|...|.:..:|.::.|.|              :::|:||......||.|:|||:....||:
Human   266 SSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFF 330

  Fly    87 RNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPI 151
            |||.:|:.|||::.|.:::||.|:..:::....:|.:.:.|::|.|.:|.|:.|.: ...|.|..
Human   331 RNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRL-EPESEYYK 394

  Fly   152 TQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGG 216
            .:||.|.|.||||.::|..:.|:|.|||:|..|.|||....|.|||..|..    |||||.:..|
Human   395 LRLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAH----SNLNGVWYRG 455

  Fly   217 NHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            .|. .:.:..|:.|.|::|.:||.|.|.:|:||
Human   456 GHY-RSRYQDGVYWAEFRGGSYSLKKVVMMIRP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 80/228 (35%)
ANGPTL2NP_036230.1 FReD 273..487 CDD:238040 75/219 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.