DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and FGL1

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_004458.3 Gene:FGL1 / 2267 HGNCID:3695 Length:312 Species:Homo sapiens


Alignment Length:236 Identity:92/236 - (38%)
Similarity:125/236 - (52%) Gaps:27/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KKYSSSCKEL---NPKKSGVQKIQVGSDVIE--VYCDVTIAGKGWLVVQRRVSVEENFYRNWTSY 92
            |:..:.|.|:   ..|.||..||:......|  ||||::..| ||.|:|||....|||.|.|..|
Human    77 KRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGG-GWTVIQRRSDGSENFNRGWKDY 140

  Fly    93 QTGFGDL---KGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQL 154
            :.|||:.   .|.:::|..||:.:::.:...|.|:|.||....|||.|..|.||:..:.|.: .:
Human   141 ENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYEL-NI 204

  Fly   155 GAYSGTAGDSL-----------SYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSN 208
            |.|||||||||           :.|....|||:|||:||...|||......||:..|.|    :|
Human   205 GEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHS----AN 265

  Fly   209 LNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            |||.|..|.:|  |...:||||..|.|:.||.|:|.:.:||
Human   266 LNGVYYSGPYT--AKTDNGIVWYTWHGWWYSLKSVVMKIRP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 91/235 (39%)
FGL1NP_004458.3 FReD 78..304 CDD:238040 89/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.