DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and FGG

DIOPT Version :10

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_068656.2 Gene:FGG / 2266 HGNCID:3694 Length:453 Species:Homo sapiens


Alignment Length:251 Identity:74/251 - (29%)
Similarity:115/251 - (45%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IQTYKKYSSSCKEL---NPKKSG---VQKIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYR 87
            :|.:......|:::   ..|:||   ::.::.....: |||::..:|.||.|.|:|:....:|.:
Human   169 VQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFL-VYCEIDGSGNGWTVFQKRLDGSVDFKK 232

  Fly    88 NWTSYQTGFGDLK----GNFFIGLNNLNKIS--SLQPQELYIELVDFAGEKRYAHYSVFHVGNVY 146
            ||..|:.|||.|.    ..|::|...::.||  |..|..|.:||.|:.|....|.|::|.||...
Human   233 NWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEA 297

  Fly   147 SNYPITQLGAYSGTAGDS--------------LSYHLYQPFSTFDRDNDNATINCAARYMGAWWY 197
            ..|.:|......|.|||:              .:.|....|||:|.|||....|||.:....||.
Human   298 DKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWM 362

  Fly   198 RECLSRIPCSNLNGAYL-GGNH---TDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            .:|    ...:|||.|. ||.:   :.|..:.:||:|..||...||.|...:.:.|
Human   363 NKC----HAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 73/246 (30%)
FGGNP_068656.2 Fib_alpha 30..172 CDD:462570 1/2 (50%)
Fibrinogen_C 175..414 CDD:395095 72/243 (30%)
Gamma-chain polymerization, binding amino end of another fibrin alpha chain 400..422 4/15 (27%)
Platelet aggregation and Staphylococcus clumping 423..437
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..453
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.