DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and FGG

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_068656.2 Gene:FGG / 2266 HGNCID:3694 Length:453 Species:Homo sapiens


Alignment Length:251 Identity:74/251 - (29%)
Similarity:115/251 - (45%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IQTYKKYSSSCKEL---NPKKSG---VQKIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYR 87
            :|.:......|:::   ..|:||   ::.::.....: |||::..:|.||.|.|:|:....:|.:
Human   169 VQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFL-VYCEIDGSGNGWTVFQKRLDGSVDFKK 232

  Fly    88 NWTSYQTGFGDLK----GNFFIGLNNLNKIS--SLQPQELYIELVDFAGEKRYAHYSVFHVGNVY 146
            ||..|:.|||.|.    ..|::|...::.||  |..|..|.:||.|:.|....|.|::|.||...
Human   233 NWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEA 297

  Fly   147 SNYPITQLGAYSGTAGDS--------------LSYHLYQPFSTFDRDNDNATINCAARYMGAWWY 197
            ..|.:|......|.|||:              .:.|....|||:|.|||....|||.:....||.
Human   298 DKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWM 362

  Fly   198 RECLSRIPCSNLNGAYL-GGNH---TDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            .:|    ...:|||.|. ||.:   :.|..:.:||:|..||...||.|...:.:.|
Human   363 NKC----HAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 73/246 (30%)
FGGNP_068656.2 Fib_alpha 31..172 CDD:285864 1/2 (50%)
FReD 175..414 CDD:294064 72/243 (30%)
Gamma-chain polymerization, binding amino end of another fibrin alpha chain 400..422 4/15 (27%)
Platelet aggregation and Staphylococcus clumping 423..437
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.