DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and FGB

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_005132.2 Gene:FGB / 2244 HGNCID:3662 Length:491 Species:Homo sapiens


Alignment Length:264 Identity:86/264 - (32%)
Similarity:129/264 - (48%) Gaps:49/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NVKIQTYKKYSSSCKELNPK---KSGVQKIQVGSDV--IEVYCDVTIAGKGWLVVQRRVSVEENF 85
            |:.:.:.|:    |:|:..|   .|.:..||..|.|  ..||||:.....||.|:|.|.....:|
Human   232 NIPVVSGKE----CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDF 292

  Fly    86 YRNWTSYQTGFGD------------LKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYS 138
            .|.|..|:.|||:            |.|.:::|.:.:::::.:.|.||.||:.|:.|:|..|||.
Human   293 GRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYG 357

  Fly   139 VFHVGNVYSNYPITQLGAYSGTAGDSL--------------SYHLYQPFSTFDRDND-----NAT 184
            .|.|.|..:.|.|: :..|.||||::|              :.|....|||:|||||     :..
Human   358 GFTVQNEANKYQIS-VNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPR 421

  Fly   185 INCAARYMGAWWYRECLSRIPCSNLNGAYL-GGNHT-DPALFGS--GIVWGEWKGFTYSYKTVNI 245
            ..|:....|.|||..|    ..:|.||.|. ||.:| |.|..|:  |:||..|||..||.:.:::
Human   422 KQCSKEDGGGWWYNRC----HAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSM 482

  Fly   246 MVRP 249
            .:||
Human   483 KIRP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 84/256 (33%)
FGBNP_005132.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..75
Beta-chain polymerization, binding distal domain of another fibrin 45..47
Fib_alpha 92..234 CDD:312286 1/1 (100%)
FReD 237..486 CDD:294064 83/257 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.