DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and FCN1

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001994.2 Gene:FCN1 / 2219 HGNCID:3623 Length:326 Species:Homo sapiens


Alignment Length:233 Identity:89/233 - (38%)
Similarity:131/233 - (56%) Gaps:13/233 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EIGENVKIQTYKKYSSSCKELNPK---KSGVQKIQV-GSDVIEVYCDVTIAGKGWLVVQRRVSVE 82
            |.|:..:.|:......:||:|..:   .||...|.: ....:.|.||:...|.||.|.|||:...
Human   101 EKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGS 165

  Fly    83 ENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYS 147
            .:|||:|.:|:.|||...|.|::|.:|::.:::....||.::||||.|..::|.|..|.|.:...
Human   166 VDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAE 230

  Fly   148 NYPITQLGAY-SGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNG 211
            .|.:. |||: .|:||:||:.|....|||.|:|||.::.|||.::.|||||.:|    ..|||||
Human   231 KYKLV-LGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADC----HASNLNG 290

  Fly   212 AYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            .||.|.|..   :.:||.|...||:.||||...:.|||
Human   291 LYLMGPHES---YANGINWSAAKGYKYSYKVSEMKVRP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 86/221 (39%)
FCN1NP_001994.2 Collagen 51..107 CDD:189968 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..111 3/9 (33%)
FReD 115..325 CDD:238040 84/217 (39%)
A domain, contributes to trimerization 115..154 10/38 (26%)
B domain, contributes to trimerization 155..243 32/88 (36%)
Carbohydrate-binding. /evidence=ECO:0000269|PubMed:17897951 282..284 1/5 (20%)
P domain. /evidence=ECO:0000303|PubMed:17148457 317..326 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1518
Inparanoid 1 1.050 188 1.000 Inparanoid score I3915
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.