DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Tnc

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001356140.1 Gene:Tnc / 21923 MGIID:101922 Length:2110 Species:Mus musculus


Alignment Length:206 Identity:90/206 - (43%)
Similarity:125/206 - (60%) Gaps:15/206 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SGVQKIQVGSD---VIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLN 108
            ||:..|.:..|   .:|||||:|..|.||:|..||.:..|:|||||.:|..||||.:..|::||:
Mouse  1904 SGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLD 1968

  Fly   109 NLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPF 173
            ||:||::....||.::|.|. ||..||.|..|.||:..|.|.: ::..||||||||::||..:.|
Mouse  1969 NLSKITAQGQYELRVDLQDH-GESAYAVYDRFSVGDAKSRYKL-KVEGYSGTAGDSMNYHNGRSF 2031

  Fly   174 STFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTY 238
            ||:|:|.|:|..|||..|.||:||:.| .|:   ||.|.|...||:      .|:.|..|||..|
Mouse  2032 STYDKDTDSAITNCALSYKGAFWYKNC-HRV---NLMGRYGDNNHS------QGVNWFHWKGHEY 2086

  Fly   239 SYKTVNIMVRP 249
            |.:...:.:||
Mouse  2087 SIQFAEMKLRP 2097

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 90/206 (44%)
TncNP_001356140.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..91
EGF_2 222..247 CDD:285248
EGF_2 345..372 CDD:285248
EGF_2 377..403 CDD:285248
EGF_2 408..434 CDD:285248
EGF_2 468..496 CDD:285248
EGF_2 504..527 CDD:285248
EGF_2 533..558 CDD:285248
EGF_2 592..620 CDD:285248
FN3 624..710 CDD:238020
fn3 713..793 CDD:333790
FN3 804..891 CDD:238020
fn3 894..976 CDD:333790
fn3 986..1064 CDD:333790
fn3 1075..1147 CDD:333790
fn3 1169..1246 CDD:333790
fn3 1257..1336 CDD:333790
fn3 1348..1417 CDD:333790
fn3 1442..1519 CDD:333790
fn3 1530..1610 CDD:333790
fn3 1620..1699 CDD:333790
fn3 1711..1785 CDD:333790
fn3 1797..1869 CDD:333790
Fibrinogen_C 1889..2098 CDD:278572 90/206 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3753
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.