DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and T15B7.1

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_504743.3 Gene:T15B7.1 / 188512 WormBaseID:WBGene00020516 Length:372 Species:Caenorhabditis elegans


Alignment Length:211 Identity:64/211 - (30%)
Similarity:95/211 - (45%) Gaps:36/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SGVQKIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFY-RNWTSYQTGFGDL--KGNFFIGLN 108
            ||...|.|.....||:||:...|.||::.|.|....|::: |.|..|:.||||:  ..||::|..
 Worm   157 SGTYTILVNGKETEVWCDMQTYGGGWVLFQNRFDDSESYWDRKWDEYKNGFGDVDENSNFWLGNE 221

  Fly   109 NLNKISSLQPQELYIEL-----------VDFAGEKRYAHYSVFHVGNVYSNYPITQLG------- 155
            .|:.:::.:...|.:|:           .||    .:.||..|.||:...|||:..|.       
 Worm   222 ALHVMTTNKKVTLRVEMYGDRTPNSKNATDF----WFGHYFDFQVGSKTQNYPLLDLTMDWANPI 282

  Fly   156 AYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARY-MGAWWYRECLSRIPCSNLNGAYLGGNHT 219
            ..:.||...|:..:..||||.|..:|... .|..:: ||.||.:.|    ..|.|||||...:..
 Worm   283 GNASTAWYDLTCSIGSPFSTIDNIHDPVK-ECVTKFQMGGWWLKNC----ALSTLNGAYTPKDWN 342

  Fly   220 DPALFGSGIVWGEWKG 235
            :    |.|:.| .|.|
 Worm   343 N----GYGMFW-IWDG 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 64/211 (30%)
T15B7.1NP_504743.3 CLECT 21..138 CDD:214480
FReD 144..368 CDD:294064 64/211 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I3641
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.920

Return to query results.
Submit another query.