DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Y43C5A.2

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_501883.1 Gene:Y43C5A.2 / 177911 WormBaseID:WBGene00012782 Length:452 Species:Caenorhabditis elegans


Alignment Length:268 Identity:79/268 - (29%)
Similarity:108/268 - (40%) Gaps:63/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GENVKIQTYKKYSSSCKEL-NPKKSGVQKIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYR 87
            |..:...|..|....|.|: |...||||.|......::||||.|..|. :.|:|.|.:..||...
 Worm   183 GSTLPPTTTPKPPMDCSEISNLTSSGVQTIYPNGSPVQVYCDTTSYGT-YTVIQSRGATGENVNF 246

  Fly    88 NWTSYQTGFGDLKG------NFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAH--YSVFHVGN 144
            |.| |.. :.|:.|      ||:.||:|:|.:|..:|..|.|:|.  .|....|.  |..|.||.
 Worm   247 NIT-YDK-YTDIIGTPGKETNFWFGLDNMNHLSGAKPYRLQIDLC--CGTLLVAKQIYHSFKVGT 307

  Fly   145 VYSNYPITQLG-------AYSGTAGDSLSYHLYQPFSTFD-------RDN-------DNATINCA 188
            ....|.:|...       |||.|..|     |...|||||       :|:       |::.:.  
 Worm   308 AEYGYNLTATADISGIGLAYSSTYTD-----LGAKFSTFDNFTGPLGKDDCDEFQYFDDSGVQ-- 365

  Fly   189 ARYMGAWWYRECLSRIPCSNLNGAYL---GGNHTDP-------ALFG------SGIVWGEWKGFT 237
            ::..|.|||..|     .:||||.:.   .||.|.|       .:.|      ||..:|.:....
 Worm   366 SQPYGGWWYGSC-----GNNLNGFWYPKRNGNCTVPDEVFKNTTMLGINMRTTSGQGYGGYNVDM 425

  Fly   238 YSYKTVNI 245
            .||..|.:
 Worm   426 VSYDRVRM 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 77/258 (30%)
Y43C5A.2NP_501883.1 FReD 196..438 CDD:238040 76/255 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.