DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and C49C8.5

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_501481.2 Gene:C49C8.5 / 177668 WormBaseID:WBGene00016769 Length:451 Species:Caenorhabditis elegans


Alignment Length:240 Identity:67/240 - (27%)
Similarity:99/240 - (41%) Gaps:58/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TYKKYSSSCKELNPKKSGVQKIQV-GSDVIEVYCDVTIAGKGWLVVQRRVSVEENF--------Y 86
            |..|..|.|.|:....||:|.|.. ||..:.||||...:...:.::|.|.....|.        |
 Worm   186 TTAKLPSDCDEVESTSSGLQTIYPDGSTPVSVYCDRKNSAGAYTIIQSRGREGSNITFDIPFANY 250

  Fly    87 RNWTSYQTGFGDLKGNFFIGLNNLNKISSL-QPQELYIELVDFAGEKRYAH--YSVFHVGNVYSN 148
            .:|.. ::|.|.   ||::||:|:|.:|:. :...|.|:|.  .|.:..|.  |:.|.|......
 Worm   251 SDWFG-ESGVGK---NFWLGLDNMNNLSTNGKTYSLQIDLC--CGTQLMAKQLYTNFKVATKAEQ 309

  Fly   149 YPITQ------LGA-YSGTAGDSLSYHLYQPFST------------------FDRDNDNATINCA 188
            |.:|.      :|. ||.:|.|     |..||||                  :|.||..|.   .
 Worm   310 YALTASADLPGIGLDYSSSAKD-----LGAPFSTQLTYSLPKGKAECDQFEFYDDDNGGAG---P 366

  Fly   189 ARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPAL--FGSGIVWG 231
            ::..|.|||..|     .:||||.....|:.|.::  |.|.::.|
 Worm   367 SKGYGGWWYGSC-----GNNLNGFLYPNNNGDCSVTKFDSTLLLG 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 66/237 (28%)
C49C8.5NP_501481.2 FReD 190..437 CDD:294064 65/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.