DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Fgl2

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_032039.2 Gene:Fgl2 / 14190 MGIID:103266 Length:432 Species:Mus musculus


Alignment Length:238 Identity:83/238 - (34%)
Similarity:120/238 - (50%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YKKYSSSCKE---LNPKKSGVQKIQVG--SDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTS 91
            ||    .|.:   |..:.||..::...  :...|||||:...|.||.|:|.|:....||.|.|..
Mouse   203 YK----DCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKD 263

  Fly    92 YQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGA 156
            |:.|||:|:..|::|.:.::.::..:...|.|:|.||.|...||.|..|:|.|.:..|.: .:|.
Mouse   264 YKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRL-HIGN 327

  Fly   157 YSGTAGDSLSY-----HLYQPFSTFDRDNDN-ATINCAARYMGAWWYRECLSRIPCSNLNGAYLG 215
            |:|||||:|.:     |..:.|:|.|||||. .:.||...|...||:..|||    :||||.|. 
Mouse   328 YNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLS----ANLNGKYY- 387

  Fly   216 GNHTDPALFGSGIVWGEWK--------GFTYSYKTVNIMVRPK 250
              |.......:||.||.|.        |:..|:|...:|:|||
Mouse   388 --HQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 79/234 (34%)
Fgl2NP_032039.2 Uds1 72..151 CDD:292096
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Fibrinogen_C 202..428 CDD:278572 81/236 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.