DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Fga

DIOPT Version :10

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001104518.1 Gene:Fga / 14161 MGIID:1316726 Length:789 Species:Mus musculus


Alignment Length:234 Identity:86/234 - (36%)
Similarity:118/234 - (50%) Gaps:33/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LNPKKSGVQ------KIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDL- 99
            |..:.||.|      |....|.|..||||...:..|||::|:|:....||.|.|..|:.|||.| 
Mouse   559 LQTQTSGAQNGIFSIKPPGSSKVFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLN 623

  Fly   100 ---KGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTA 161
               :|.|::| |:...:.:|:...|.:||.|:||::.||.|. |.||:....|.: |:.:|.|||
Mouse   624 DKGEGEFWLG-NDYLHLLTLRGSVLRVELEDWAGKEAYAEYH-FRVGSEAEGYAL-QVSSYRGTA 685

  Fly   162 GDSL-----------SYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLG 215
            ||:|           :.|....|||||||.|....|||..|.|.|||..|    ..:||||.|..
Mouse   686 GDALVQGSVEEGTEYTSHSNMQFSTFDRDADQWEENCAEVYGGGWWYNSC----QAANLNGIYYP 746

  Fly   216 GNHTDPA-----LFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            |...||.     ...:|:||..::|..||.:.|.:.:||
Mouse   747 GGTYDPRNNSPYEIENGVVWVPFRGADYSLRAVRMKIRP 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 86/234 (37%)
FgaNP_001104518.1 Fib_alpha 50..192 CDD:462570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..420
dermokine <265..>401 CDD:455732
Fibrinogen_aC 392..457 CDD:432370
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 526..555
FReD 550..786 CDD:238040 86/234 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.