DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Fcna

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_032021.1 Gene:Fcna / 14133 MGIID:1340905 Length:334 Species:Mus musculus


Alignment Length:236 Identity:92/236 - (38%)
Similarity:132/236 - (55%) Gaps:17/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LASAEIGENVKIQTYKKYSSSCKELNPK---KSGVQKIQV-GSDVIEVYCDVTIAGKGWLVVQRR 78
            |...|:|:.:    .::...|||:|..:   .:|...|.: ....:.|.||:.:.|.||.|.|||
Mouse   109 LGEKELGDTL----CQRGPRSCKDLLTRGIFLTGWYTIHLPDCRPLTVLCDMDVDGGGWTVFQRR 169

  Fly    79 VSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVG 143
            |....:|:|:|.||:.|||:|...|::|.:.|:.:::...|||.::|.||.|:..||.||.|.|.
Mouse   170 VDGSIDFFRDWDSYKRGFGNLGTEFWLGNDYLHLLTANGNQELRVDLQDFQGKGSYAKYSSFQVS 234

  Fly   144 NVYSNYPITQLGAY-SGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCS 207
            .....|.:| ||.: .|||||||:.|....|:|.|:|||..::||||.:.|||||..|..    |
Mouse   235 EEQEKYKLT-LGQFLEGTAGDSLTKHNNMSFTTHDQDNDANSMNCAALFHGAWWYHNCHQ----S 294

  Fly   208 NLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVR 248
            ||||.||.|:|..   :..||.||..:|..||||...:.:|
Mouse   295 NLNGRYLSGSHES---YADGINWGTGQGHHYSYKVAEMKIR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 89/220 (40%)
FcnaNP_032021.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..117 3/7 (43%)
Collagen 65..106 CDD:189968
FReD 123..332 CDD:238040 88/216 (41%)
A domain, contributes to trimerization. /evidence=ECO:0000250 123..162 10/38 (26%)
B domain, contributes to trimerization. /evidence=ECO:0000250 163..251 35/88 (40%)
Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 290..292 0/1 (0%)
P domain. /evidence=ECO:0000250|UniProtKB:O00602 325..334 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm43211
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.