DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Angpt4

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_033771.1 Gene:Angpt4 / 11602 MGIID:1336887 Length:509 Species:Mus musculus


Alignment Length:237 Identity:73/237 - (30%)
Similarity:112/237 - (47%) Gaps:29/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VKIQTYKKYSSSCKELNPKKSGVQKIQV-------GSDVIEVYCDVTIAGKGWLVVQRRVSVEEN 84
            |.::|.|.....|.|:  |:|||....|       .:..::|:||:...|.||.::|.|.....|
Mouse   285 VSLKTPKPVFQDCAEI--KRSGVNTSGVYTIYETNMTKPLKVFCDMETDGGGWTLIQHREDGSVN 347

  Fly    85 FYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNY 149
            |.|.|..|:.|||::....::|...:::::|.....|.:||.|:.|.:....|..|.:|:....|
Mouse   348 FQRTWEEYKEGFGNVAREHWLGNEAVHRLTSRTAYLLRVELHDWEGRQTSIQYENFQLGSERQRY 412

  Fly   150 PITQLGAYSGTAG--DSLSYHLYQP----FSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSN 208
            .:: :...|.:||  :||:     |    |||.|.||||....||....|.||:..|    ..||
Mouse   413 SLS-VNDSSSSAGRKNSLA-----PQGTKFSTKDMDNDNCMCKCAQMLSGGWWFDAC----GLSN 467

  Fly   209 LNGAYLG-GNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            |||.|.. ..|....   :||.|..::|.:||.....:|:||
Mouse   468 LNGIYYSVHQHLHKI---NGIRWHYFRGPSYSLHGTRMMLRP 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 70/230 (30%)
Angpt4NP_033771.1 BMFP 140..217 CDD:294701
FReD 292..507 CDD:238040 70/230 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..436 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.