DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and angptl3

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_571893.2 Gene:angptl3 / 114421 ZFINID:ZDB-GENE-010817-3 Length:466 Species:Danio rerio


Alignment Length:220 Identity:77/220 - (35%)
Similarity:111/220 - (50%) Gaps:12/220 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YSSSCKEL---NPKKSGVQKIQVG-SDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTG 95
            :.:.|.|:   ..|.||:..|:.. |:...|||::|..|.. .|:|||.....:|.::|..|:.|
Zfish   249 FPADCSEVFTRGQKTSGIYPIKPNQSEPFYVYCEITPDGAA-TVIQRREDGSVDFDQSWEKYEHG 312

  Fly    96 FGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGT 160
            ||.|:..|::||..::.|:......|:|||.|:..|||:..|: |.:....|:|.: .|...||.
Zfish   313 FGKLEKEFWLGLAKIHSIAQQGEYILHIELEDWKEEKRFIEYT-FTLEGPASDYAL-HLAPLSGD 375

  Fly   161 AGDSLSYHLYQPFSTFDRDNDN-ATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALF 224
            ..|::|.|....|||.|||||| ...|||..|.|.||:..|..    :||||.|...........
Zfish   376 LSDAMSNHTGMKFSTKDRDNDNHDESNCARNYTGGWWFDACGD----TNLNGRYAWMRSKARHQR 436

  Fly   225 GSGIVWGEWKGFTYSYKTVNIMVRP 249
            ..||.|...||.:|:.|:..|.:||
Zfish   437 RKGIYWRPSKGSSYTLKSTKITIRP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 77/220 (35%)
angptl3NP_571893.2 SMC_N <111..>209 CDD:330553
FReD 248..461 CDD:238040 75/218 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.