DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and angpt2b

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_571889.1 Gene:angpt2b / 114408 ZFINID:ZDB-GENE-010817-2 Length:489 Species:Danio rerio


Alignment Length:219 Identity:70/219 - (31%)
Similarity:106/219 - (48%) Gaps:17/219 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CKELNPKKSGVQK-------IQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGF 96
            |.|:  .||||.:       :...:..|:|:||:...|.||.|.|.|.....:|.|:|..|:.||
Zfish   277 CAEI--FKSGVTENGIYSIHLPNSTQKIKVFCDMKTKGGGWTVFQHRYDGSVDFNRDWNDYKLGF 339

  Fly    97 GDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTA 161
            ||..|..::|.:.::.:::.:...|.:.|.|....:.|:.|..|::......|.:...| :||||
Zfish   340 GDPSGEHWLGNDVIHLLTTTKDYTLQVHLKDAEEHQAYSQYDTFYIDGEDKKYSLHARG-FSGTA 403

  Fly   162 GDSLSY-HLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFG 225
            |.:.|. |....|||.|:|||..:..||....|.||:..|    ..|||||.|..||..  .:..
Zfish   404 GRTSSLTHSGTQFSTKDQDNDQCSCKCAQMATGGWWFEAC----GPSNLNGIYYSGNSN--VIRY 462

  Fly   226 SGIVWGEWKGFTYSYKTVNIMVRP 249
            :.|.|..|||.::......:|:||
Zfish   463 NSIKWYYWKGPSWMATMTTMMIRP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 70/219 (32%)
angpt2bNP_571889.1 NYD-SP28 164..244 CDD:291438
FReD 274..487 CDD:238040 70/219 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.