DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Fcnb

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_446086.1 Gene:Fcnb / 114091 RGDID:621222 Length:319 Species:Rattus norvegicus


Alignment Length:217 Identity:82/217 - (37%)
Similarity:112/217 - (51%) Gaps:24/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YKKYSSSCKELNPKKSGVQKIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGF 96
            |..|...|:.|.                 |.||:...|.||.|.|||:....:|:|:||||:.||
  Rat   125 YTIYLPDCRPLT-----------------VLCDMDTDGGGWTVFQRRIDGTVDFFRDWTSYKQGF 172

  Fly    97 GDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTA 161
            |...|.|::|.:|::.:::....||.::|.||.|...:|.||.|.:......|.:.......|.|
  Rat   173 GSQLGEFWLGNDNIHALTTQGTNELRVDLADFDGNHDFAKYSSFQIQGEAEKYKLILGNFLGGGA 237

  Fly   162 GDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGS 226
            ||||:......|||.|:|||..:.|||.||.|||||.:|.:    |||||.||.|.|..   :.:
  Rat   238 GDSLTSQNNMLFSTKDQDNDQGSSNCAVRYHGAWWYSDCHT----SNLNGLYLRGLHKS---YAN 295

  Fly   227 GIVWGEWKGFTYSYKTVNIMVR 248
            |:.|..|||:.||||...:.||
  Rat   296 GVNWKSWKGYNYSYKVSEMKVR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 81/215 (38%)
FcnbNP_446086.1 Collagen 45..100 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..106
FReD 108..317 CDD:238040 80/215 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1518
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.