DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and FGL2

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_006673.1 Gene:FGL2 / 10875 HGNCID:3696 Length:439 Species:Homo sapiens


Alignment Length:222 Identity:79/222 - (35%)
Similarity:114/222 - (51%) Gaps:32/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NPKKSGVQKIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGL 107
            :||.|.          .|||||:...|.||.|:|.|:....||.|.|..|:.|||:|:..|::|.
Human   232 DPKNSS----------FEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGN 286

  Fly   108 NNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSY----- 167
            :.::.::..:...|.|:|.||.|.:.||.|..|:|.|.:..|.: .:|.|:|||||:|.:     
Human   287 DKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRL-HVGNYNGTAGDALRFNKHYN 350

  Fly   168 HLYQPFSTFDRDNDN-ATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWG 231
            |..:.|:|.|:|||. .:.||...|...||:..|||    :||||.|.   |.......:||.||
Human   351 HDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLS----ANLNGKYY---HQKYRGVRNGIFWG 408

  Fly   232 EWK--------GFTYSYKTVNIMVRPK 250
            .|.        |:..|:|...:|:|||
Human   409 TWPGVSEAHPGGYKSSFKEAKMMIRPK 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 77/220 (35%)
FGL2NP_006673.1 DUF460 <28..>161 CDD:331991
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..126
FReD 209..435 CDD:294064 77/220 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.