Sequence 1: | NP_001246376.1 | Gene: | CG5550 / 36883 | FlyBaseID: | FBgn0034160 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006673.1 | Gene: | FGL2 / 10875 | HGNCID: | 3696 | Length: | 439 | Species: | Homo sapiens |
Alignment Length: | 222 | Identity: | 79/222 - (35%) |
---|---|---|---|
Similarity: | 114/222 - (51%) | Gaps: | 32/222 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 NPKKSGVQKIQVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGL 107
Fly 108 NNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSY----- 167
Fly 168 HLYQPFSTFDRDNDN-ATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWG 231
Fly 232 EWK--------GFTYSYKTVNIMVRPK 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5550 | NP_001246376.1 | FReD | 34..250 | CDD:238040 | 77/220 (35%) |
FGL2 | NP_006673.1 | DUF460 | <28..>161 | CDD:331991 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 103..126 | ||||
FReD | 209..435 | CDD:294064 | 77/220 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X25 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |