DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and LOC105947509

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_031760299.1 Gene:LOC105947509 / 105947509 -ID:- Length:304 Species:Xenopus tropicalis


Alignment Length:225 Identity:86/225 - (38%)
Similarity:113/225 - (50%) Gaps:20/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YKKYS-SSCKEL---NPKKSGVQKI-QVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTS 91
            |..|: :|||:|   ....||...| .||...:.|.||:...|.||||.|||.....:|..:|.:
 Frog    89 YSLYNGTSCKDLLNQGEYLSGWNIITPVGMSPLRVLCDMHTDGGGWLVFQRRWDGTVSFNVDWNT 153

  Fly    92 YQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGA 156
            |:.|||.....|::|.:.|..::|....||.|:|.||.....||.||.|.:....:||.:. ||:
 Frog   154 YKRGFGSEMNEFWLGNDILYNLTSSGTWELRIDLRDFDNNMYYAKYSFFQILGEDNNYTLL-LGS 217

  Fly   157 YS-GTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAY--LGGNH 218
            |: |..||||:.|...||||:||||:....|||....|.|||..|..    |||||.|  :..|.
 Frog   218 YNEGNIGDSLTPHNTVPFSTYDRDNNFLLENCAFDNQGGWWYNNCYQ----SNLNGLYRLVQNNE 278

  Fly   219 TDPALFGSGIVWGEWKGFTYSYKTVNIMVR 248
            |       ||.|.......||||:..:.:|
 Frog   279 T-------GINWLSDGRNHYSYKSSEMKIR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 85/223 (38%)
LOC105947509XP_031760299.1 Collagen <65..88 CDD:396114
FReD 93..303 CDD:238040 84/221 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.