DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and Angptl7

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_006239486.1 Gene:Angptl7 / 102552055 RGDID:7553363 Length:408 Species:Rattus norvegicus


Alignment Length:223 Identity:91/223 - (40%)
Similarity:129/223 - (57%) Gaps:21/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSCKELNPKKSGVQKIQ----VGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFG 97
            ||..:.|.:.|||.|:.    :||..:||:||:..:|.||.::|||.|...:||::|..|:.|||
  Rat   194 SSLYQKNYRISGVYKLPPDEFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYQDWKQYKQGFG 258

  Fly    98 DLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAG 162
            .::|:|::|..::::::. ||..|.:||.|:.|..|||.||.|.:||..::|.:. ||.|||..|
  Rat   259 SIRGDFWLGNEHIHRLTR-QPTRLRVELEDWEGNARYAEYSYFALGNELNSYRLF-LGNYSGNVG 321

  Fly   163 -DSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAY--LGGN--HTDPA 222
             |:|.||....|||.|:||||....||....|.:||..|..    |||||.|  ||.:  |.|  
  Rat   322 KDALLYHNNTVFSTKDKDNDNCLDKCAQLRKGGYWYNCCTD----SNLNGVYYRLGEHRKHMD-- 380

  Fly   223 LFGSGIVWGEWKGFTYSYKTVNIMVRPK 250
                ||.|..|.|..||.|.|.:.:||:
  Rat   381 ----GISWYGWHGANYSLKRVEMKIRPE 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 90/221 (41%)
Angptl7XP_006239486.1 FReD 191..403 CDD:238040 89/220 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.