DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and si:ch211-157b11.8

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_009300879.1 Gene:si:ch211-157b11.8 / 101884863 ZFINID:ZDB-GENE-131127-436 Length:392 Species:Danio rerio


Alignment Length:237 Identity:80/237 - (33%)
Similarity:115/237 - (48%) Gaps:32/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YSSSCKE---LNPKKSGVQKIQVG--SDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQT 94
            |...|.|   |..|::|:..||..  ...:|..||:..||.||.|.|||...:.:|.|.|..|:.
Zfish   165 YPQDCHEIYQLGIKENGIYTIQPDPKQPALEAVCDMVSAGGGWTVFQRRFDGKTDFNRTWQEYRD 229

  Fly    95 GFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSG 159
            |||..:...::|...|..:::.....|.|.|.|:..:.|:|:|:.|.|......:.:| ...|.|
Zfish   230 GFGSPQTEHWLGNAVLYALTANGQHTLRITLQDWHEQTRHANYNNFKVAGENQRFRLT-AREYHG 293

  Fly   160 TAGDSLSY-----HLYQPFSTFDRDNDN-ATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNH 218
            .||::.||     |..:.|||:|||:|. |..|||..|...||:..||:    :||||.:..|.:
Zfish   294 DAGNAFSYSKQYNHDGRAFSTYDRDHDRYAAGNCARYYGAGWWFDSCLA----ANLNGRFYHGRY 354

  Fly   219 ---TDPALFGSGIVWGEW-------KGFTYSYKTVNIMVRPK 250
               ||      ||.||.|       .|..||:|:|.:..||:
Zfish   355 SGITD------GIYWGTWYILTEYRTGERYSFKSVEMKTRPR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 79/235 (34%)
si:ch211-157b11.8XP_009300879.1 FReD 165..390 CDD:238040 79/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.