DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and fcn2l

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_004917606.2 Gene:fcn2l / 101735093 XenbaseID:XB-GENE-22167163 Length:301 Species:Xenopus tropicalis


Alignment Length:241 Identity:86/241 - (35%)
Similarity:125/241 - (51%) Gaps:30/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EIGENVKIQTYKKYSS-SCKELNPK-----------KSGVQKIQVGSDVIEVYCDVTIAGKGWLV 74
            |.|:|....::  |:: :||||..:           ..|||.       ::|.||:...|.||:|
 Frog    77 EKGDNQDALSF--YAARNCKELLDQGEVLSDWYIIYPDGVQP-------MKVLCDMHTDGGGWIV 132

  Fly    75 VQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSV 139
            .|||.....:|:|:|.||::|||.....|::|.:||:|::|....||.::|.||...|.:|.|..
 Frog   133 FQRRWDGSVDFFRDWKSYKSGFGSRLNEFWLGNDNLHKLTSSGTWELRVDLQDFENAKHFAKYES 197

  Fly   140 FHVGNVYSNYPITQLGAY-SGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSR 203
            |.:......:.:. :||. .|...|::..|...||||.|:|||....:||.||.|.|||..|.. 
 Frog   198 FRILGESEKFKLL-IGAMKGGNIEDAMKVHNTMPFSTKDQDNDILPEHCADRYKGGWWYNGCHH- 260

  Fly   204 IPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
               |||||.||.|:|::.|   .||.|...:|..||||...:.:||
 Frog   261 ---SNLNGLYLLGSHSNTA---EGINWYGGRGHNYSYKRSEMKIRP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 83/229 (36%)
fcn2lXP_004917606.2 Collagen 38..>79 CDD:396114 1/1 (100%)
FReD 91..300 CDD:238040 80/223 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.