DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and mfap4.11

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_003197842.1 Gene:mfap4.11 / 100538113 ZFINID:ZDB-GENE-121214-183 Length:244 Species:Danio rerio


Alignment Length:255 Identity:90/255 - (35%)
Similarity:129/255 - (50%) Gaps:26/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALCVFSLGLFYLASAEIGENVKIQTYKKYSSSCKEL---NPKKSGVQKIQVGSDV-IEVYCDVTI 67
            |:.||.:.|..:.:|.:     :..:|.:  .|.|:   ....|||..|....|. :.|||.:..
Zfish     2 AMTVFVVALLSVFTASV-----VSGFKPF--DCSEIYKSGQTVSGVYSIYPAGDTPVWVYCQMIS 59

  Fly    68 AGK-----GWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVD 127
            .||     ||.|.|||:....|||:.|..|:.|||..:|.:::||.||.:::..:...|.::|.|
Zfish    60 DGKDEENGGWTVFQRRMDGRINFYQPWEVYKRGFGTTEGEYWLGLENLYQLTRHKKFMLRVDLED 124

  Fly   128 FAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYM 192
            |.|.|.:|.||.|.||:....|.:...|...|.||||||.|..:.|||.|:|.|....|||..::
Zfish   125 FEGRKVFAQYSSFSVGSEAEGYKLQVSGFTDGGAGDSLSAHNDRKFSTLDKDQDLYEKNCARYFL 189

  Fly   193 GAWWYRECLSRIPC--SNLNGAYLGGNHTDPALFGSGIVWGEWK-GFTYSYKTVNIMVRP 249
            |.:||     .:.|  :|.||.||.|.|.  ..:..|:||..|| .||.|.||..:.::|
Zfish   190 GGFWY-----TVGCHYTNPNGMYLWGEHN--TRYAIGVVWSTWKNSFTLSMKTFLMKIKP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 84/228 (37%)
mfap4.11XP_003197842.1 FReD 24..243 CDD:238040 84/228 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6355
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.