DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and mfap4.7

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_009294426.1 Gene:mfap4.7 / 100538070 ZFINID:ZDB-GENE-121214-96 Length:243 Species:Danio rerio


Alignment Length:254 Identity:88/254 - (34%)
Similarity:135/254 - (53%) Gaps:25/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALCVFSLGLFYLASAEIGENVKIQTYKKYSSSCKEL---NPKKSGVQKIQVGSDV-IEVYCDVTI 67
            |:.||.:.|..:.:|.:     :..:|.:  .|.|:   ....||:..|....|. :.|||::..
Zfish     2 AMTVFVVALLSVFTASV-----VSGFKPF--DCSEIYKSGQTGSGIYSIYPAGDTPVWVYCEMVS 59

  Fly    68 A-----GKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVD 127
            .     ..||.|.|||:....|||:.|..|:.|||..:|.:::||.||.:::..:...|.::|.|
Zfish    60 RMMDGFNGGWTVFQRRMDGSINFYQPWEEYKKGFGTTEGEYWLGLENLYQLTRQKKFMLKVDLED 124

  Fly   128 FAGEKRYAHYSVFHVGNVYSNYPITQLGAYS-GTAGDSLSYHLYQPFSTFDRDNDNATINCAARY 191
            |.|.:.:|.||.|.||:....|.: |:.|:: |.|||||:||....|||||:|.||:..|||...
Zfish   125 FTGRRGFAQYSSFSVGSEAEGYKL-QVSAFTDGGAGDSLAYHNQMKFSTFDKDQDNSVKNCAKLN 188

  Fly   192 MGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKG-FTYSYKTVNIMVRP 249
            :||:|||:|..    :|.||.||.|.  |..:||.|.||..|.. :....|::.:.::|
Zfish   189 LGAFWYRDCHH----TNPNGVYLWGE--DATIFGIGNVWYAWTNKYATGLKSITMKIKP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 82/227 (36%)
mfap4.7XP_009294426.1 FReD 24..242 CDD:238040 82/227 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6355
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.