DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and mfap4.10

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001314993.1 Gene:mfap4.10 / 100537823 ZFINID:ZDB-GENE-121214-100 Length:245 Species:Danio rerio


Alignment Length:221 Identity:78/221 - (35%)
Similarity:117/221 - (52%) Gaps:16/221 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CKEL---NPKKSGVQKI-QVGSDVIEVYCDVTIAGK-----GWLVVQRRVSVEENFYRNWTSYQT 94
            |.|:   ....||:..| ..|:..:.|||.:...||     ||.|.|||:....|||:.|..|:.
Zfish    29 CSEIYKSGQTGSGIYSIYPAGNTPVWVYCQMISEGKVQDNGGWTVFQRRLDGRINFYQPWEEYKR 93

  Fly    95 GFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSG 159
            |||..:|.:::||.||.:::..:...|.::|.||.|.:.:|.||.|.||:....|.:...|...|
Zfish    94 GFGTTEGEYWLGLENLYQLTRHKNYMLRVDLEDFTGRRGFAQYSSFSVGSEAEGYKLQISGFTDG 158

  Fly   160 TAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALF 224
            .||||:::|....|||:|:|.|..:.|||...:||:|||.|.    .:|.||.|:||.  |..::
Zfish   159 GAGDSMTHHNGMKFSTYDKDQDIDSRNCARLRLGAFWYRNCY----YANPNGVYIGGE--DSTIY 217

  Fly   225 GSGIVWGEWK-GFTYSYKTVNIMVRP 249
            ..|.||..|| ...:..|.:.:.::|
Zfish   218 AIGDVWYSWKNNANFGMKLITMKIKP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 78/221 (35%)
mfap4.10NP_001314993.1 FReD 26..244 CDD:238040 78/221 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.