DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and fgl1b

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_002936775.2 Gene:fgl1b / 100497330 XenbaseID:XB-GENE-5957151 Length:330 Species:Xenopus tropicalis


Alignment Length:249 Identity:86/249 - (34%)
Similarity:122/249 - (48%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ENVKIQT-------YKKYSSSCKELNPKKSGVQKI--QVGSDVIEVYCDVTIAGKGWLVVQRRVS 80
            |:|.:.|       |.:..||..|...|:||..::  :..::...|:||::..| ||.|:|||.:
 Frog    77 EDVLLPTTSGNLIVYNEDCSSVFESGRKESGYYRVRPRAENEPFLVFCDMSDGG-GWTVIQRRSN 140

  Fly    81 VEENFYRNWTSYQTGFGDLKG---NFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHV 142
            .:.||.|.|..|:.|||..|.   ..:||.|::..:...:...|.|:|.|:.|..::|.|..|.:
 Frog   141 GKVNFNRKWDEYKEGFGLFKSRNDEHWIGNNHIYDLLDKREMTLKIDLTDWQGNAKHAIYETFRL 205

  Fly   143 GNVYSNYPITQLGAYSGTAGDSLS-----------YHLYQPFSTFDRDNDN-ATINCAARYMGAW 195
            .|...||.: .:|.|||.|||.||           .|...||||.|:|||. ...|||......|
 Frog   206 TNEQDNYKL-WIGYYSGNAGDGLSGGSNFEQQWSASHSGMPFSTSDKDNDRFIKGNCAKENKCGW 269

  Fly   196 WYRECLSRIPCSNLNGAYL-GGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVR 248
            |:..|    ..:||||.|. .||:|..  |.:||||..|.|..||.|:..:.:|
 Frog   270 WFNRC----HAANLNGVYYKKGNYTGE--FDNGIVWSPWHGLWYSLKSTAMKIR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 82/233 (35%)
fgl1bXP_002936775.2 FReD 94..318 CDD:238040 82/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.