DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and LOC100495637

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_004917595.2 Gene:LOC100495637 / 100495637 -ID:- Length:289 Species:Xenopus tropicalis


Alignment Length:229 Identity:86/229 - (37%)
Similarity:123/229 - (53%) Gaps:30/229 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SSSCKELNPKKSGVQKIQVGSDV-------------IEVYCDVTIAGKGWLVVQRRVSVEENFYR 87
            :.:|||.         :..||.:             :.|:||:...|.||.|.|||.....:|||
 Frog    76 TKNCKEW---------LDQGSSITGWYPIYTPTGRRLLVFCDMETDGGGWTVFQRRADGSVDFYR 131

  Fly    88 NWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPIT 152
            :|.||:.|||..:..|::|.:||:.:::....:|.::|.||:.::.||.||.|.:.....||.::
 Frog   132 DWNSYKRGFGRKESEFWLGNDNLHLLTATGNFQLRVDLTDFSEQRTYAAYSNFRIAGEAQNYTLS 196

  Fly   153 QLGAYSGTAGDSLSYHLYQPFSTFDRDND-NATINCAARYMGAWWYRECLSRIPCSNLNGAYLGG 216
            ..|...|.||||||.|....||:.||||| :.|.:||..|.|.|||.:|..    |||||.||||
 Frog   197 LGGFTGGDAGDSLSGHNGYSFSSKDRDNDVHLTGSCAQSYKGGWWYSKCHG----SNLNGLYLGG 257

  Fly   217 NHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRPK 250
            |||.   :.:|:.|...||:.||||...:..||:
 Frog   258 NHTS---YANGVNWSAGKGYHYSYKVSEMKFRPQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 85/227 (37%)
LOC100495637XP_004917595.2 Collagen 40..>75 CDD:396114
FReD 77..287 CDD:238040 84/225 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1518
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.