DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and tnc

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_004916768.1 Gene:tnc / 100494697 XenbaseID:XB-GENE-1002816 Length:1829 Species:Xenopus tropicalis


Alignment Length:244 Identity:98/244 - (40%)
Similarity:135/244 - (55%) Gaps:34/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLGLFYLASAEIGENVKIQTYKKYSSSCKE--LNPK-KSGVQKIQVGSD---VIEVYCDVTIAGK 70
            ::||.|                .|...|.:  ||.: .||:..|.|..|   .:|||||:::.|.
 Frog  1601 TIGLLY----------------PYPKDCSQALLNGEADSGLYTIYVNGDQSQPMEVYCDMSVDGG 1649

  Fly    71 GWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYA 135
            ||:|..||....|.|||||.:|..|||::...||:||.||:|::||...||.::|.| ..|..||
 Frog  1650 GWIVFLRRTDGSEEFYRNWKTYSAGFGNINNEFFMGLENLHKLTSLGQYELRVDLRD-NDETAYA 1713

  Fly   136 HYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYREC 200
            .|..|.||:..|.:.: ::..||||||||::||..:.|||||:|||:|..|||..|.||:||:.|
 Frog  1714 VYDKFSVGDAKSRFRL-KVEGYSGTAGDSMTYHNGRSFSTFDKDNDSAITNCALSYKGAFWYKNC 1777

  Fly   201 LSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
             .|:   ||.|.|...||:      .|:.|..|||..||.:...:.:||
 Frog  1778 -HRV---NLMGRYGDTNHS------QGVNWFHWKGHEYSIQFAEMKIRP 1816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 95/222 (43%)
tncXP_004916768.1 EGF_Tenascin 187..214 CDD:376143
EGF_Tenascin 249..276 CDD:376143
EGF_Tenascin 280..307 CDD:376143
DSL <295..337 CDD:366627
EGF_Tenascin 342..369 CDD:376143
EGF_Tenascin 373..399 CDD:376143
EGF_Tenascin 404..431 CDD:376143
EGF_Tenascin 435..461 CDD:376143
EGF_Tenascin 466..492 CDD:376143
EGF_Tenascin 497..524 CDD:376143
EGF_Tenascin 528..554 CDD:376143
EGF_Tenascin 559..586 CDD:376143
EGF_Tenascin 590..617 CDD:376143
fn3 620..691 CDD:365830
fn3 713..789 CDD:365830
fn3 799..877 CDD:365830
fn3 887..969 CDD:365830
fn3 979..1056 CDD:365830
fn3 1074..1147 CDD:365830
fn3 1158..1230 CDD:365830
fn3 1249..1329 CDD:365830
fn3 1339..1418 CDD:365830
fn3 1428..1506 CDD:365830
fn3 1518..1594 CDD:365830
FReD 1607..1817 CDD:238040 95/222 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9330
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.