DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and fgl2

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_002933134.2 Gene:fgl2 / 100494596 XenbaseID:XB-GENE-482375 Length:429 Species:Xenopus tropicalis


Alignment Length:243 Identity:89/243 - (36%)
Similarity:125/243 - (51%) Gaps:28/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NVKIQTYKKYSSSCKELNPKKSGVQKIQVGSD----VIEVYCDVTIAGKGWLVVQRRVSVEENFY 86
            |..||...|..|...::..|..|  :.:|..|    ..|||||:...|.||.|||.|.....:|.
 Frog   193 NPSIQLLYKDCSDYYKIGKKVDG--RYRVTPDEKNKTFEVYCDMESMGGGWTVVQIRKDGSTSFN 255

  Fly    87 RNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPI 151
            |.|..|:.|||:|.|.|::|.:.|:.::......|.|||.||.|.:.||.|..|:|.|.|..|.:
 Frog   256 RTWNEYKNGFGNLTGEFWLGNDKLHLLTKSTDMILRIELEDFKGNREYAKYDQFYVANEYLKYRL 320

  Fly   152 TQLGAYSGTAGDSLSY-----HLYQPFSTFDRDNDN-ATINCAARYMGAWWYRECLSRIPCSNLN 210
            | :|.|||||||:|.:     |..:.|:|.|:|||. .:.||.:.|...||:..|:|    :|||
 Frog   321 T-IGGYSGTAGDALHFSKQYNHDQKFFTTPDKDNDRYPSGNCGSYYSSGWWFDACMS----ANLN 380

  Fly   211 GAYLGGNHTDPALFGSGIVWGEWKG--------FTYSYKTVNIMVRPK 250
            |.|...::..   ..:||.||.|.|        :..::|.|.:|:|||
 Frog   381 GKYYKNDYKG---VRNGIFWGTWTGVSDEHLNSYRQTFKFVKMMIRPK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 84/233 (36%)
fgl2XP_002933134.2 Smc <53..164 CDD:224117
FReD 199..425 CDD:238040 84/235 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.