DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and angptl5

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_031752234.1 Gene:angptl5 / 100493165 XenbaseID:XB-GENE-479274 Length:347 Species:Xenopus tropicalis


Alignment Length:249 Identity:74/249 - (29%)
Similarity:108/249 - (43%) Gaps:41/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YKKYSSSCKELNPKKSGVQKIQVGSDVI---------EVYCDVTIAGKGWLVVQRRVSVEENFYR 87
            ::.:...|.::......|.|...|..:|         |.:||:...|.||.|:|:|:....:|.|
 Frog   102 FQTHGFDCSDIKDTFHSVSKFPSGLYIIQPEGTYYPFEAFCDMDYQGGGWTVIQKRIDGSVDFQR 166

  Fly    88 NWTSYQTGFGDLKGNFFIGLNN----LNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSN 148
            :|..|..|||||.|.|::||..    ||:.::.....:.:|..|  |...||.|..|.:.: .||
 Frog   167 SWIDYMEGFGDLSGEFWLGLKKTFCILNQKNTSFMLSIALEAED--GTLAYASYDSFWLED-ESN 228

  Fly   149 YPITQLGAYSGTAGDSL------SYHLYQPFSTFDRDNDNATINCAA-----------RYMGAWW 196
            ..|..:|.|||||||:|      ......||||||.|||....:|..           .....||
 Frog   229 QFIMHVGRYSGTAGDALRGFKKEDNQNAMPFSTFDADNDRCNPSCTVNGKSINSCSLLNNRSGWW 293

  Fly   197 YRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRPK 250
            :.:|    ..:||||.:......|.    |||.|..||....:.|..::.::.|
 Frog   294 FSQC----GLANLNGVHKVTRLVDI----SGIHWNTWKEDKENVKIKSVSMKIK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 73/245 (30%)
angptl5XP_031752234.1 FReD 108..340 CDD:238040 74/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.