DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and angptl4

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_002938598.2 Gene:angptl4 / 100492339 XenbaseID:XB-GENE-481750 Length:457 Species:Xenopus tropicalis


Alignment Length:241 Identity:81/241 - (33%)
Similarity:114/241 - (47%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ASAEIGENVKIQTYKKYSSSCKEL---NPKKSGVQKIQ-VGSDVIEVYCDVTIAGKGWLVVQRRV 79
            :|.|.|::|       :.|.|.::   ..|.||:..|| .|:...||||::| |..||.|.|||.
 Frog   228 SSTEEGKHV-------FPSDCHQIFLEGKKSSGIFSIQPSGAQPFEVYCEMT-ADAGWTVTQRRT 284

  Fly    80 SVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSV-FHVG 143
            ....:|.|.|.:|..|||:|.|.|::||..:::|:......::|:|.|:  |....|... |.:.
 Frog   285 DGSVDFDRLWDAYTDGFGNLNGEFWLGLEKMHQITQQGQYLIHIDLQDW--ENNVQHMEAKFLLA 347

  Fly   144 NVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDND-NATINCAARYMGAWWYRECLSRIPCS 207
            .....|.:..||..:|...::||......|||.|||.| .:..|||....|.||:..|    ..|
 Frog   348 GSNEAYALQLLGPVTGELENALSDFQQLQFSTRDRDQDKKSDFNCAKHLSGGWWFSSC----GHS 408

  Fly   208 NLNGAYL----GGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            ||||.|.    ...|...    .||.|..|||..|..|:.:|.:||
 Frog   409 NLNGKYFLSVPRARHERK----QGIFWKTWKGRYYPLKSTSIKIRP 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 77/226 (34%)
angptl4XP_002938598.2 Smc <55..>234 CDD:224117 2/5 (40%)
FReD 237..451 CDD:238040 77/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48348
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.