DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and angpt4.2

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001191044.1 Gene:angpt4.2 / 100491105 XenbaseID:XB-GENE-5875042 Length:263 Species:Xenopus tropicalis


Alignment Length:286 Identity:74/286 - (25%)
Similarity:123/286 - (43%) Gaps:75/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LGLFYL---------------ASAEIGENVKIQTYKKYSSSCKEL----NPKKSGVQKIQV--GS 56
            :|||||               .|:|:     ..|.......|..:    |...||:..|:.  .|
 Frog     1 MGLFYLRQFGCLLFLGVHVQWVSSEV-----FPTENPLGYDCSHIWERNNESVSGIYTIKPLGAS 60

  Fly    57 DVIEVYCDVTIAGKGWLVVQRRVSVEE-NFYRNWTSYQTGFGDLKGNFFIGLNNLNKISS--LQP 118
            ...:|:|::...| ||.::||....:. .|.|.|..|:.|||::.|..::||.|::.:::  .:.
 Frog    61 TSFQVFCEMKADG-GWTLIQRHDGQDGLLFTRTWAEYKLGFGNISGEHWLGLENMHILTNQDSRA 124

  Fly   119 QELYIELVDF-AGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSL---------SYHLYQPF 173
            .||:|.|..| ..:..:|.||.|.|......|.:: :|.|||.|||:.         ::     |
 Frog   125 SELFISLEAFDDSDGAFALYSSFIVAPESKLYQLS-VGNYSGNAGDAFRTGNNNQDGNF-----F 183

  Fly   174 STFDRDND--------NATINCAARYMGA--WWYRECLSRIPCSNLNGAY------LGGNHTDPA 222
            :|.|:|||        :...:..:||..:  ||:..|.:    :||||.:      :|       
 Frog   184 TTKDKDNDKCNPCKIGDTRFSSCSRYQSSSGWWFSSCGN----ANLNGQWRPEENNVG------- 237

  Fly   223 LFGSGIVWGEWKGFTYSYKTVNIMVR 248
             :.|.:.||.::. |.|.|...:.||
 Frog   238 -WASSVHWGSYRA-TESLKYSKMFVR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 66/250 (26%)
angpt4.2NP_001191044.1 FReD 32..261 CDD:238040 64/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.