DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and LOC100488486

DIOPT Version :10

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_012826223.1 Gene:LOC100488486 / 100488486 XenbaseID:XB-GENE-29079231 Length:237 Species:Xenopus tropicalis


Alignment Length:199 Identity:78/199 - (39%)
Similarity:106/199 - (53%) Gaps:24/199 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQE 120
            |:.:.||||::.:|..|.|.|:|.....||:|.|..||:|||.....:::||:|:..::..:|..
 Frog    39 SNPVSVYCDMSSSGGPWTVFQKRFDGSVNFFRGWREYQSGFGQANKEYWLGLHNIYLLTLTKPSW 103

  Fly   121 LYIELVDFAGEKRYAHYSVFHVGNVYSNYPIT-------------QLGAYSGTAGDSLSYHLYQP 172
            |.|:|.||....|:|.|..|.:    |.:.|:             :.|..|...|||..:|...|
 Frog   104 LRIDLEDFENNTRFATYKDFSL----SRFAISPEEDGYRLNIAGFEEGDKSNPIGDSFGWHNGMP 164

  Fly   173 FSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFT 237
            |||||.|.||.|.|||..|.|.:|||.|    ..|||||.||||::...|:   |:||..|||..
 Frog   165 FSTFDNDRDNTTENCANSYKGGFWYRHC----HASNLNGRYLGGHNNQYAV---GLVWNSWKGHN 222

  Fly   238 YSYK 241
            ||.|
 Frog   223 YSLK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 78/199 (39%)
LOC100488486XP_012826223.1 FReD 12..232 CDD:238040 78/199 (39%)

Return to query results.
Submit another query.